SCOP 1.75: Domain d2i5eb1: 2i5e B:1-208

Lineage for d2i5eb1 (2i5e B:1-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families)

5. Family c.68.1.21: MM2497-like [159723] (1 protein)
   Pfam PF01983; DUF121

6. Protein Hypothetical protein MM2497 [159724] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [159725] (1 PDB entry)
   Uniprot Q8PU52 1-208

8. Domain d2i5eb1: 2i5e B:1-208 [147511]
   automatically matched to 2I5E A:1-208
   complexed with peg, trs

Details for d2i5eb1

PDB Entry: 2i5e, 2.1 Å

PDB Description: Crystal Structure of a Protein of Unknown Function MM2497 from Methanosarcina mazei Go1, Probable Nucleotidyltransferase

PDB Compounds: (B:) Hypothetical protein MM_2497

SCOP Domain Sequences for d2i5eb1:

Sequence; same for both SEQRES and ATOM records:

>d2i5eb1 c.68.1.21 (B:1-208) Hypothetical protein MM2497 {Methanosarcina mazei [TaxId: 2209]}
mravipykkagaksrlspvlslqereefvelmlnqvisslkgagieqvdilspsvyglee
mtearvlldekdlnealnrylkeaeepvlivmadlpllspehikeisstekdvcivpgkg
ggtnalfiknpskyrvkyygssflthcsiatdsgqdfeiydsfmagtdidepedlvelli
hgkgaakdyieskfrlevkkgrvglvpl

Timeline for d2i5eb1:

• d2i5eb1 is new in SCOP 1.75
  
• d2i5eb1 is called d2i5eb_ in SCOPe 2.01
  
• d2i5eb1 appears in the current release, SCOPe 2.08, called d2i5eb2