![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) ![]() |
![]() | Family c.68.1.21: MM2497-like [159723] (1 protein) Pfam PF01983; DUF121 |
![]() | Protein Hypothetical protein MM2497 [159724] (1 species) |
![]() | Species Methanosarcina mazei [TaxId:2209] [159725] (1 PDB entry) Uniprot Q8PU52 1-208 |
![]() | Domain d2i5ea1: 2i5e A:1-208 [147510] complexed with peg, trs |
PDB Entry: 2i5e (more details), 2.1 Å
SCOP Domain Sequences for d2i5ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i5ea1 c.68.1.21 (A:1-208) Hypothetical protein MM2497 {Methanosarcina mazei [TaxId: 2209]} mravipykkagaksrlspvlslqereefvelmlnqvisslkgagieqvdilspsvyglee mtearvlldekdlnealnrylkeaeepvlivmadlpllspehikeisstekdvcivpgkg ggtnalfiknpskyrvkyygssflthcsiatdsgqdfeiydsfmagtdidepedlvelli hgkgaakdyieskfrlevkkgrvglvpl
Timeline for d2i5ea1: