Lineage for d2i5cb_ (2i5c B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803222Protein Pleckstrin [50740] (1 species)
  7. 2803223Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 2803226Domain d2i5cb_: 2i5c B: [147508]
    automated match to d1x05a1
    complexed with ip5

Details for d2i5cb_

PDB Entry: 2i5c (more details), 1.75 Å

PDB Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,4,5)P5
PDB Compounds: (B:) Pleckstrin

SCOPe Domain Sequences for d2i5cb_:

Sequence, based on SEQRES records: (download)

>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvesn
sngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records): (download)

>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
lfeiitadevhyflqaatpkertewikaiqmasr

SCOPe Domain Coordinates for d2i5cb_:

Click to download the PDB-style file with coordinates for d2i5cb_.
(The format of our PDB-style files is described here.)

Timeline for d2i5cb_: