![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Pleckstrin [50740] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries) |
![]() | Domain d2i5cb_: 2i5c B: [147508] automated match to d1x05a1 complexed with ip5 |
PDB Entry: 2i5c (more details), 1.75 Å
SCOPe Domain Sequences for d2i5cb_:
Sequence, based on SEQRES records: (download)
>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvesn sngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen lfeiitadevhyflqaatpkertewikaiqmasr
Timeline for d2i5cb_: