SCOPe 2.08: Domain d2i5cb_: 2i5c B:

Lineage for d2i5cb_ (2i5c B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d2i5cb_: 2i5c B: [147508]
   automated match to d1x05a1
   complexed with ip5

Details for d2i5cb_

PDB Entry: 2i5c, 1.75 Å

PDB Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,4,5)P5

PDB Compounds: (B:) Pleckstrin

SCOPe Domain Sequences for d2i5cb_:

Sequence, based on SEQRES records:

>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvesn
sngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records):

>d2i5cb_ b.55.1.1 (B:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
lfeiitadevhyflqaatpkertewikaiqmasr

Timeline for d2i5cb_:

• d2i5cb_ first appeared in SCOP 1.75, called d2i5cb1
  
• d2i5cb_ appears in SCOPe 2.07