Lineage for d2i5ca1 (2i5c A:244-347)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805291Protein Pleckstrin [50740] (1 species)
  7. 805292Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 805294Domain d2i5ca1: 2i5c A:244-347 [147507]
    automatically matched to d1xx0a1
    complexed with ip5

Details for d2i5ca1

PDB Entry: 2i5c (more details), 1.75 Å

PDB Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,4,5)P5
PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d2i5ca1:

Sequence, based on SEQRES records: (download)

>d2i5ca1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvesn
sngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records): (download)

>d2i5ca1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsveen
lfeiitadevhyflqaatpkertewikaiqmasr

SCOP Domain Coordinates for d2i5ca1:

Click to download the PDB-style file with coordinates for d2i5ca1.
(The format of our PDB-style files is described here.)

Timeline for d2i5ca1: