SCOPe 2.08: Domain d2i4rb2: 2i4r B:-2-79

Lineage for d2i4rb2 (2i4r B:-2-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.149: AtpF-like [159467] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.149.1: AtpF-like [159468] (2 families)
   automatically mapped to Pfam PF01990

5. Family c.149.1.1: AtpF-like [159469] (2 proteins)
   Pfam PF01990; segment-swapping in some members

6. Protein V-type ATP synthase subunit F, AtpF [159470] (4 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159472] (1 PDB entry)
   Uniprot O29102 4-79

8. Domain d2i4rb2: 2i4r B:-2-79 [147502]
   Other proteins in same PDB: d2i4ra2, d2i4rb3
   automated match to d2i4ra1

Details for d2i4rb2

PDB Entry: 2i4r, 2.8 Å

PDB Description: Crystal structure of the V-type ATP synthase subunit F from Archaeoglobus fulgidus. NESG target GR52A.

PDB Compounds: (B:) V-type ATP synthase subunit F

SCOPe Domain Sequences for d2i4rb2:

Sequence; same for both SEQRES and ATOM records:

>d2i4rb2 c.149.1.1 (B:-2-79) V-type ATP synthase subunit F, AtpF {Archaeoglobus fulgidus [TaxId: 2234]}
shmlavvgdpdftigfmlagisdiyevtsdeeivkavedvlkrddvgvvimkqeylkklp
pvlrreidekveptfvsvg

Timeline for d2i4rb2:

• d2i4rb2 first appeared in SCOP 1.75, called d2i4rb1
  
• d2i4rb2 appears in SCOPe 2.07