SCOPe 2.08: Domain d2i3da1: 2i3d A:2-219

Lineage for d2i3da1 (2i3d A:2-219)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.36: Atu1826-like [159742] (2 proteins)

6. Protein Hypothetical protein Atu1826 [159745] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159746] (1 PDB entry)
   Uniprot Q8UED4 2-219

8. Domain d2i3da1: 2i3d A:2-219 [147499]
   complexed with cl, mg

Details for d2i3da1

PDB Entry: 2i3d, 1.5 Å

PDB Description: Crystal Structure of Protein of Unknown Function ATU1826, a Putative Alpha/Beta Hydrolase from Agrobacterium tumefaciens

PDB Compounds: (A:) Hypothetical protein Atu1826

SCOPe Domain Sequences for d2i3da1:

Sequence; same for both SEQRES and ATOM records:

>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}
pevifngpagrlegryqpskeksapiaiilhphpqfggtmnnqivyqlfylfqkrgfttl
rfnfrsigrsqgefdhgagelsdaasaldwvqslhpdskscwvagysfgawigmqllmrr
peiegfmsiapqpntydfsflapcpssgliingdadkvapekdvnglveklktqkgilit
hrtlpganhffngkvdelmgecedyldrrlngelvpep

Timeline for d2i3da1:

• d2i3da1 first appeared in SCOP 1.75
  
• d2i3da1 appears in SCOPe 2.07