SCOP 1.75: Domain d2i3ba1: 2i3b A:1-189

Lineage for d2i3ba1 (2i3b A:1-189)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Cancer-related NTPase, C1orf57 [159566] (1 species)
   member of Pfam PF03266; DUF265

7. Species Human (Homo sapiens) [TaxId:9606] [159567] (1 PDB entry)
   Uniprot Q5TDE9 2-190

8. Domain d2i3ba1: 2i3b A:1-189 [147497]

Details for d2i3ba1

PDB Entry: 2i3b

PDB Description: solution structure of a human cancer-related nucleoside triphosphatase

PDB Compounds: (A:) Human Cancer-Related NTPase

SCOP Domain Sequences for d2i3ba1:

Sequence; same for both SEQRES and ATOM records:

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}
arhvfltgppgvgkttlihkasevlkssgvpvdgfyteevrqggrrigfdvvtlsgtrgp
lsrvglepppgkrecrvgqyvvdltsfeqlalpvlrnadcssgpgqrvcvideigkmelf
sqlfiqavrqtlstpgtiilgtipvpkgkplalveeirnrkdvkvfnvtkenrnhllpdi
vtcvqssrk

Timeline for d2i3ba1:

• d2i3ba1 is new in SCOP 1.75
  
• d2i3ba1 appears in SCOPe 2.01
  
• d2i3ba1 appears in the current release, SCOPe 2.08