Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (1 family) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.1: ASF1-like [101547] (2 proteins) |
Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries) Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156 |
Domain d2i32a1: 2i32 A:1-154 [147495] |
PDB Entry: 2i32 (more details), 2.7 Å
SCOPe Domain Sequences for d2i32a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i32a1 b.1.22.1 (A:1-154) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]} makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet elrenppvkpdfsklqrnilasnprvtrfhinwe
Timeline for d2i32a1: