Lineage for d2i32a1 (2i32 A:1-154)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112427Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 1112428Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1112429Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1112448Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
    Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156
  8. 1112449Domain d2i32a1: 2i32 A:1-154 [147495]

Details for d2i32a1

PDB Entry: 2i32 (more details), 2.7 Å

PDB Description: structure of a human asf1a-hira complex and insights into specificity of histone chaperone complex assembly
PDB Compounds: (A:) Anti-Silencing Factor 1 paralog a

SCOPe Domain Sequences for d2i32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i32a1 b.1.22.1 (A:1-154) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwe

SCOPe Domain Coordinates for d2i32a1:

Click to download the PDB-style file with coordinates for d2i32a1.
(The format of our PDB-style files is described here.)

Timeline for d2i32a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i32b1