Lineage for d2i2lc_ (2i2l C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434357Fold b.172: YopX-like [159005] (1 superfamily)
    consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold
  4. 2434358Superfamily b.172.1: YopX-like [159006] (2 families) (S)
    conmrises proteins of plasmid and phage origins
  5. 2434359Family b.172.1.1: YopX-like [159007] (3 proteins)
    Pfam PF09643
  6. 2434366Protein Hypothetical protein YopX [159010] (1 species)
  7. 2434367Species Bacillus subtilis [TaxId:1423] [159011] (1 PDB entry)
    Uniprot O34401 1-134
  8. 2434370Domain d2i2lc_: 2i2l C: [147494]
    Other proteins in same PDB: d2i2lb3
    automated match to d2i2la1

Details for d2i2lc_

PDB Entry: 2i2l (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein yopX from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR411.
PDB Compounds: (C:) YopX protein

SCOPe Domain Sequences for d2i2lc_:

Sequence, based on SEQRES records: (download)

>d2i2lc_ b.172.1.1 (C:) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]}
mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv
rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskisadydvtavgwveyatievi
gdvyqnpelle

Sequence, based on observed residues (ATOM records): (download)

>d2i2lc_ b.172.1.1 (C:) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]}
mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv
rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskdydvtavgwveyatievigdv
yqnpelle

SCOPe Domain Coordinates for d2i2lc_:

Click to download the PDB-style file with coordinates for d2i2lc_.
(The format of our PDB-style files is described here.)

Timeline for d2i2lc_: