![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.172: YopX-like [159005] (1 superfamily) consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold |
![]() | Superfamily b.172.1: YopX-like [159006] (2 families) ![]() conmrises proteins of plasmid and phage origins |
![]() | Family b.172.1.1: YopX-like [159007] (3 proteins) Pfam PF09643 |
![]() | Protein Hypothetical protein YopX [159010] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159011] (1 PDB entry) Uniprot O34401 1-134 |
![]() | Domain d2i2lb2: 2i2l B:1-134 [147493] Other proteins in same PDB: d2i2lb3 automated match to d2i2la1 |
PDB Entry: 2i2l (more details), 2.8 Å
SCOPe Domain Sequences for d2i2lb2:
Sequence, based on SEQRES records: (download)
>d2i2lb2 b.172.1.1 (B:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]} mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskisadydvtavgwveyatievi gdvyqnpellegvk
>d2i2lb2 b.172.1.1 (B:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]} mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskdydvtavgwveyatievigdv yqnpellegvk
Timeline for d2i2lb2: