SCOP 1.75: Domain d2i2la1: 2i2l A:1-134

Lineage for d2i2la1 (2i2l A:1-134)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.172: YopX-like [159005] (1 superfamily)
   consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold

4. Superfamily b.172.1: YopX-like [159006] (1 family)
   conmrises proteins of plasmid and phage origins

5. Family b.172.1.1: YopX-like [159007] (3 proteins)
   Pfam PF09643

6. Protein Hypothetical protein YopX [159010] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159011] (1 PDB entry)
   Uniprot O34401 1-134

8. Domain d2i2la1: 2i2l A:1-134 [147492]

Details for d2i2la1

PDB Entry: 2i2l, 2.8 Å

PDB Description: X-ray Crystal Structure of Protein yopX from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR411.

PDB Compounds: (A:) YopX protein

SCOP Domain Sequences for d2i2la1:

Sequence, based on SEQRES records:

>d2i2la1 b.172.1.1 (A:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]}
mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv
rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskisadydvtavgwveyatievi
gdvyqnpellegvk

Sequence, based on observed residues (ATOM records):

>d2i2la1 b.172.1.1 (A:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]}
mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv
rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskydvtavgwveyatievigdvy
qnpellegvk

Timeline for d2i2la1:

• d2i2la1 is new in SCOP 1.75
  
• d2i2la1 appears in SCOPe 2.01
  
• d2i2la1 appears in the current release, SCOPe 2.08