Class b: All beta proteins [48724] (174 folds) |
Fold b.172: YopX-like [159005] (1 superfamily) consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold |
Superfamily b.172.1: YopX-like [159006] (1 family) conmrises proteins of plasmid and phage origins |
Family b.172.1.1: YopX-like [159007] (3 proteins) Pfam PF09643 |
Protein Hypothetical protein YopX [159010] (1 species) |
Species Bacillus subtilis [TaxId:1423] [159011] (1 PDB entry) Uniprot O34401 1-134 |
Domain d2i2la1: 2i2l A:1-134 [147492] |
PDB Entry: 2i2l (more details), 2.8 Å
SCOP Domain Sequences for d2i2la1:
Sequence, based on SEQRES records: (download)
>d2i2la1 b.172.1.1 (A:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]} mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskisadydvtavgwveyatievi gdvyqnpellegvk
>d2i2la1 b.172.1.1 (A:1-134) Hypothetical protein YopX {Bacillus subtilis [TaxId: 1423]} mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakv rgkfiydrsivkitsddkessdvcevkfsdgvfqvdvskydvtavgwveyatievigdvy qnpellegvk
Timeline for d2i2la1: