SCOPe 2.04: Domain d2i27o_: 2i27 O:

Lineage for d2i27o_ (2i27 O:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)

8. Domain d2i27o_: 2i27 O: [147491]
   automated match to d1sq2n_

Details for d2i27o_

PDB Entry: 2i27, 1.92 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor Ancestral variable domain

PDB Compounds: (O:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i27o_:

Sequence, based on SEQRES records:

>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna

Sequence, based on observed residues (ATOM records):

>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvna

Timeline for d2i27o_:

• d2i27o_ first appeared in SCOP 1.75, called d2i27o1
  
• d2i27o_ appears in SCOPe 2.03
  
• d2i27o_ appears in SCOPe 2.05
  
• d2i27o_ appears in the current release, SCOPe 2.08, called d2i27o2