Lineage for d2i27o_ (2i27 O:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105645Protein automated matches [190119] (15 species)
    not a true protein
  7. 1105871Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (3 PDB entries)
  8. 1105875Domain d2i27o_: 2i27 O: [147491]
    automated match to d1sq2n_

Details for d2i27o_

PDB Entry: 2i27 (more details), 1.92 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor Ancestral variable domain
PDB Compounds: (O:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i27o_:

Sequence, based on SEQRES records: (download)

>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna

Sequence, based on observed residues (ATOM records): (download)

>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvna

SCOPe Domain Coordinates for d2i27o_:

Click to download the PDB-style file with coordinates for d2i27o_.
(The format of our PDB-style files is described here.)

Timeline for d2i27o_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i27n_