![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (15 species) not a true protein |
![]() | Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (3 PDB entries) |
![]() | Domain d2i27o_: 2i27 O: [147491] automated match to d1sq2n_ |
PDB Entry: 2i27 (more details), 1.92 Å
SCOPe Domain Sequences for d2i27o_:
Sequence, based on SEQRES records: (download)
>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna
>d2i27o_ b.1.1.1 (O:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvna
Timeline for d2i27o_: