Lineage for d2i27o2 (2i27 O:2-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020482Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries)
  8. 2020487Domain d2i27o2: 2i27 O:2-112 [147491]
    Other proteins in same PDB: d2i27n3, d2i27o3
    automated match to d1sq2n_

Details for d2i27o2

PDB Entry: 2i27 (more details), 1.92 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor Ancestral variable domain
PDB Compounds: (O:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i27o2:

Sequence, based on SEQRES records: (download)

>d2i27o2 b.1.1.1 (O:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvn

Sequence, based on observed residues (ATOM records): (download)

>d2i27o2 b.1.1.1 (O:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvn

SCOPe Domain Coordinates for d2i27o2:

Click to download the PDB-style file with coordinates for d2i27o2.
(The format of our PDB-style files is described here.)

Timeline for d2i27o2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i27o3