SCOP 1.75: Domain d2i27n1: 2i27 N:2-113

Lineage for d2i27n1 (2i27 N:2-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Novel antigen receptor (against lysozyme) [110042] (1 species)

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (4 PDB entries)
   Uniprot Q8AXI4 # fragment

8. Domain d2i27n1: 2i27 N:2-113 [147490]
   automatically matched to 2I26 N:2-113

Details for d2i27n1

PDB Entry: 2i27, 1.92 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor Ancestral variable domain

PDB Compounds: (N:) New Antigen Receptor Ancestral

SCOP Domain Sequences for d2i27n1:

Sequence, based on SEQRES records:

>d2i27n1 b.1.1.1 (N:2-113) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna

Sequence, based on observed residues (ATOM records):

>d2i27n1 b.1.1.1 (N:2-113) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvna

Timeline for d2i27n1:

• d2i27n1 is new in SCOP 1.75
  
• d2i27n1 is called d2i27n_ in SCOPe 2.01
  
• d2i27n1 appears in the current release, SCOPe 2.08, called d2i27n2