| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [187220] (4 PDB entries) |
| Domain d2i27n2: 2i27 N:2-112 [147490] Other proteins in same PDB: d2i27n3, d2i27o3 automated match to d1sq2n_ |
PDB Entry: 2i27 (more details), 1.92 Å
SCOPe Domain Sequences for d2i27n2:
Sequence, based on SEQRES records: (download)
>d2i27n2 b.1.1.1 (N:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvn
>d2i27n2 b.1.1.1 (N:2-112) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrdaecaalndqygggtvvtvn
Timeline for d2i27n2: