Lineage for d2i15b1 (2i15 B:201-329)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781495Fold a.291: MG296-like [158714] (1 superfamily)
    multihelical; in crystal forms helical polymers by swapping the two N-terminal helices to the next subunit in polymer; three subunits per turn of polymer helix
  4. 781496Superfamily a.291.1: MG296-like [158715] (1 family) (S)
  5. 781497Family a.291.1.1: MG296-like [158716] (1 protein)
    Pfam PF09644
  6. 781498Protein Hypothetical protein MPN423 [158717] (1 species)
    MG296 homologue
  7. 781499Species Mycoplasma pneumoniae [TaxId:2104] [158718] (1 PDB entry)
    Uniprot P75364 1-129
  8. 781501Domain d2i15b1: 2i15 B:201-329 [147486]
    automatically matched to 2I15 A:1-129

Details for d2i15b1

PDB Entry: 2i15 (more details), 2.4 Å

PDB Description: crystal structure of mpn423 from mycoplasma pneumoniae
PDB Compounds: (B:) Hypothetical protein MG296 homolog

SCOP Domain Sequences for d2i15b1:

Sequence, based on SEQRES records: (download)

>d2i15b1 a.291.1.1 (B:201-329) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlg
krfgvltvy

Sequence, based on observed residues (ATOM records): (download)

>d2i15b1 a.291.1.1 (B:201-329) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldlpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvlt
vy

SCOP Domain Coordinates for d2i15b1:

Click to download the PDB-style file with coordinates for d2i15b1.
(The format of our PDB-style files is described here.)

Timeline for d2i15b1: