SCOPe 2.08: Domain d2i15b_: 2i15 B:

Lineage for d2i15b_ (2i15 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.291: MG296-like [158714] (1 superfamily)
   multihelical; in crystal forms helical polymers by swapping the two N-terminal helices to the next subunit in polymer; three subunits per turn of polymer helix

4. Superfamily a.291.1: MG296-like [158715] (1 family)
   automatically mapped to Pfam PF09644

5. Family a.291.1.1: MG296-like [158716] (1 protein)
   Pfam PF09644

6. Protein Hypothetical protein MPN423 [158717] (1 species)
   MG296 homologue

7. Species Mycoplasma pneumoniae [TaxId:2104] [158718] (1 PDB entry)
   Uniprot P75364 1-129

8. Domain d2i15b_: 2i15 B: [147486]
   automated match to d2i15a1

Details for d2i15b_

PDB Entry: 2i15, 2.4 Å

PDB Description: crystal structure of mpn423 from mycoplasma pneumoniae

PDB Compounds: (B:) Hypothetical protein MG296 homolog

SCOPe Domain Sequences for d2i15b_:

Sequence, based on SEQRES records:

>d2i15b_ a.291.1.1 (B:) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlg
krfgvltvy

Sequence, based on observed residues (ATOM records):

>d2i15b_ a.291.1.1 (B:) Hypothetical protein MPN423 {Mycoplasma pneumoniae [TaxId: 2104]}
mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsd
affissevvkqldlpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvlt
vy

Timeline for d2i15b_:

• d2i15b_ first appeared in SCOP 1.75, called d2i15b1
  
• d2i15b_ appears in SCOPe 2.07