![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.3: Cholesterol oxidase [64284] (2 proteins) automatically mapped to Pfam PF09129 |
![]() | Protein automated matches [254541] (1 species) not a true protein |
![]() | Species Brevibacterium sterolicum [TaxId:1702] [255228] (1 PDB entry) |
![]() | Domain d2i0ka1: 2i0k A:274-613 [147480] Other proteins in same PDB: d2i0ka2 automated match to d2i0ka1 complexed with cac, fad, gol, mn; mutant |
PDB Entry: 2i0k (more details), 1.6 Å
SCOPe Domain Sequences for d2i0ka1:
Sequence, based on SEQRES records: (download)
>d2i0ka1 d.58.32.3 (A:274-613) automated matches {Brevibacterium sterolicum [TaxId: 1702]} frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsptkp dssnevgslgsagslvgkppqarevsgpynyifsdnlpepitdmigainagnpgiaplfg pamyeitklglaatnandiwgwskdvqfyikattlrltegggavvtsraniatvindfte wfheriefyrakgefplngpveirccgldqaadvkvpsvgpptisatrprpdhpdwdvai wlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwafgpdpytdndivtnkm ratyiegvpttenwdtararynqidphrvftngfmdkllp
>d2i0ka1 d.58.32.3 (A:274-613) automated matches {Brevibacterium sterolicum [TaxId: 1702]} frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsgkpp qarevsgpynyifsdnlpepitdmigainagnpgiaplfgpamyeitklglaatnandiw gwskdvqfyikattlrltegggavvtsraniatvindftewfheriefyrakgefplngp veirccgldqaadvkvpsvgpptisatrprpdhpdwdvaiwlnvlgvpgtpgmfefyrem eqwmrshynnddatfrpewskgwafgpdpytdndivtnkmratyiegvpttenwdtarar ynqidphrvftngfmdkllp
Timeline for d2i0ka1: