Lineage for d2i06a_ (2i06 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244146Fold e.2: Replication terminator protein (Tus) [56595] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2244147Superfamily e.2.1: Replication terminator protein (Tus) [56596] (1 family) (S)
    automatically mapped to Pfam PF05472
  5. 2244148Family e.2.1.1: Replication terminator protein (Tus) [56597] (1 protein)
  6. 2244149Protein Replication terminator protein (Tus) [56598] (1 species)
  7. 2244150Species Escherichia coli [TaxId:562] [56599] (4 PDB entries)
  8. 2244151Domain d2i06a_: 2i06 A: [147479]
    automated match to d1ecra_
    protein/DNA complex; complexed with iod

Details for d2i06a_

PDB Entry: 2i06 (more details), 2.2 Å

PDB Description: Escherichia Coli Replication Terminator Protein (Tus) Complexed With DNA- Locked form
PDB Compounds: (A:) DNA replication terminus site-binding protein

SCOPe Domain Sequences for d2i06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i06a_ e.2.1.1 (A:) Replication terminator protein (Tus) {Escherichia coli [TaxId: 562]}
dlvdrlnttfrqmeqelaifaahleqhkllvarvfslpevkkedehnplnrievkqhlgn
daqslalrhfrhlfiqqqsenrsskaavrlpgvlcyqvdnlsqaalvshiqhinklkttf
ehivtveselptaarfewvhrhlpglitlnayrtltvlhdpatlrfgwankhiiknlhrd
evlaqlekslksprsvapwtreewqrklereyqdiaalpqnaklkikrpvkvqpiarvwy
kgdqkqvqhacptplialinrdngagvpdvgellnydadnvqhrykpqaqplrliiprlh
lyvad

SCOPe Domain Coordinates for d2i06a_:

Click to download the PDB-style file with coordinates for d2i06a_.
(The format of our PDB-style files is described here.)

Timeline for d2i06a_: