Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.2: Replication terminator protein (Tus) [56595] (1 superfamily) contains a cluster of helices and a beta-sandwich |
Superfamily e.2.1: Replication terminator protein (Tus) [56596] (1 family) automatically mapped to Pfam PF05472 |
Family e.2.1.1: Replication terminator protein (Tus) [56597] (1 protein) |
Protein Replication terminator protein (Tus) [56598] (1 species) |
Species Escherichia coli [TaxId:562] [56599] (4 PDB entries) |
Domain d2i06a_: 2i06 A: [147479] automated match to d1ecra_ protein/DNA complex; complexed with iod |
PDB Entry: 2i06 (more details), 2.2 Å
SCOPe Domain Sequences for d2i06a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i06a_ e.2.1.1 (A:) Replication terminator protein (Tus) {Escherichia coli [TaxId: 562]} dlvdrlnttfrqmeqelaifaahleqhkllvarvfslpevkkedehnplnrievkqhlgn daqslalrhfrhlfiqqqsenrsskaavrlpgvlcyqvdnlsqaalvshiqhinklkttf ehivtveselptaarfewvhrhlpglitlnayrtltvlhdpatlrfgwankhiiknlhrd evlaqlekslksprsvapwtreewqrklereyqdiaalpqnaklkikrpvkvqpiarvwy kgdqkqvqhacptplialinrdngagvpdvgellnydadnvqhrykpqaqplrliiprlh lyvad
Timeline for d2i06a_: