![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.10: EF1021-like [160644] (3 proteins) duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site |
![]() | Protein Putative acetyltransferase EF2353 [160645] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [160646] (1 PDB entry) Uniprot Q831Y9 10-300 |
![]() | Domain d2i00f2: 2i00 F:10-300 [147477] Other proteins in same PDB: d2i00a1, d2i00b1, d2i00c1, d2i00d1, d2i00e1, d2i00f1 automatically matched to 2I00 A:10-300 |
PDB Entry: 2i00 (more details), 2.3 Å
SCOPe Domain Sequences for d2i00f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i00f2 d.108.1.10 (F:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} ltlkpveeehidqfnellsyvfqvteadieesgfenkrafikskqpilelskvfgwfhen qlisqiaiypcevnihgalykmggvtgvgtypeyanhglmkdliqtaleemrqdkqwisy lfpynipyyrrkgweimsdklsfkirdtqlpktvpvpgmierlavdhpdvfdvyarfarq nhgalirsafnweeywrfeneeertaavyyganqeplgvlfywvadevfhikemfylnqe arnglwnfitahfsmvywvkgdiykneplaflledsqikesiepyymariv
Timeline for d2i00f2: