SCOPe 2.05: Domain d2i00e2: 2i00 E:11-300

Lineage for d2i00e2 (2i00 E:11-300)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.10: EF1021-like [160644] (3 proteins)
   duplication: consists of two NAT domains swapped with the C-terminal strands; overall structural similarity to Mycothiol synthase and N-myristoyl transferase (NMT); the similarity to NMT extends to the participation of the protein C-terminus (after the SCP2-like C-terminal domain) in the active site

6. Protein Putative acetyltransferase EF2353 [160645] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [160646] (1 PDB entry)
   Uniprot Q831Y9 10-300

8. Domain d2i00e2: 2i00 E:11-300 [147475]
   Other proteins in same PDB: d2i00a1, d2i00b1, d2i00c1, d2i00d1, d2i00e1, d2i00f1
   automated match to d2i00a2

Details for d2i00e2

PDB Entry: 2i00, 2.3 Å

PDB Description: Crystal structure of acetyltransferase (GNAT family) from Enterococcus faecalis

PDB Compounds: (E:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i00e2:

Sequence; same for both SEQRES and ATOM records:

>d2i00e2 d.108.1.10 (E:11-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}
tlkpveeehidqfnellsyvfqvteadieesgfenkrafikskqpilelskvfgwfhenq
lisqiaiypcevnihgalykmggvtgvgtypeyanhglmkdliqtaleemrqdkqwisyl
fpynipyyrrkgweimsdklsfkirdtqlpktvpvpgmierlavdhpdvfdvyarfarqn
hgalirsafnweeywrfeneeertaavyyganqeplgvlfywvadevfhikemfylnqea
rnglwnfitahfsmvywvkgdiykneplaflledsqikesiepyymariv

Timeline for d2i00e2:

• d2i00e2 first appeared in SCOP 1.75
  
• d2i00e2 appears in SCOPe 2.04
  
• d2i00e2 appears in SCOPe 2.06
  
• d2i00e2 appears in the current release, SCOPe 2.08