SCOPe 2.05: Domain d2i00e1: 2i00 E:301-406

Lineage for d2i00e1 (2i00 E:301-406)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins)

6. Protein Putative acetyltransferase EF2353 [160623] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [160624] (1 PDB entry)
   Uniprot Q831Y9 301-406

8. Domain d2i00e1: 2i00 E:301-406 [147474]
   Other proteins in same PDB: d2i00a2, d2i00b2, d2i00c2, d2i00d2, d2i00e2, d2i00f2
   automated match to d2i00a1

Details for d2i00e1

PDB Entry: 2i00, 2.3 Å

PDB Description: Crystal structure of acetyltransferase (GNAT family) from Enterococcus faecalis

PDB Compounds: (E:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i00e1:

Sequence; same for both SEQRES and ATOM records:

>d2i00e1 d.106.1.4 (E:301-406) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}
dvkaflenfpfestakpfhfvvkdpvaewnngifgliwdendqvtitdeplgtavhldiq
tltclvmnyrrpsylhrieridtdketlnslerifpdqeayfsdyf

Timeline for d2i00e1:

• d2i00e1 first appeared in SCOP 1.75
  
• d2i00e1 appears in SCOPe 2.04
  
• d2i00e1 appears in SCOPe 2.06
  
• d2i00e1 appears in the current release, SCOPe 2.08