Lineage for d2i00d1 (2i00 D:301-406)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426777Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1426778Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1426811Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins)
  6. 1426823Protein Putative acetyltransferase EF2353 [160623] (1 species)
  7. 1426824Species Enterococcus faecalis [TaxId:1351] [160624] (1 PDB entry)
    Uniprot Q831Y9 301-406
  8. 1426828Domain d2i00d1: 2i00 D:301-406 [147472]
    Other proteins in same PDB: d2i00a2, d2i00b2, d2i00c2, d2i00d2, d2i00e2, d2i00f2
    automated match to d2i00a1

Details for d2i00d1

PDB Entry: 2i00 (more details), 2.3 Å

PDB Description: Crystal structure of acetyltransferase (GNAT family) from Enterococcus faecalis
PDB Compounds: (D:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i00d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i00d1 d.106.1.4 (D:301-406) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}
dvkaflenfpfestakpfhfvvkdpvaewnngifgliwdendqvtitdeplgtavhldiq
tltclvmnyrrpsylhrieridtdketlnslerifpdqeayfsdyf

SCOPe Domain Coordinates for d2i00d1:

Click to download the PDB-style file with coordinates for d2i00d1.
(The format of our PDB-style files is described here.)

Timeline for d2i00d1: