Lineage for d2hztd1 (2hzt D:4-98)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762991Family a.4.5.69: HxlR-like [140304] (5 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))
  6. 763004Protein Putative transcriptional regulator YtcD [158294] (1 species)
  7. 763005Species Bacillus subtilis [TaxId:1423] [158295] (1 PDB entry)
    Uniprot O34533 10-104
  8. 763009Domain d2hztd1: 2hzt D:4-98 [147465]
    automatically matched to 2HZT A:4-98
    complexed with csu

Details for d2hztd1

PDB Entry: 2hzt (more details), 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd
PDB Compounds: (D:) Putative HTH-type transcriptional regulator ytcD

SCOP Domain Sequences for d2hztd1:

Sequence, based on SEQRES records: (download)

>d2hztd1 a.4.5.69 (D:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records): (download)

>d2hztd1 a.4.5.69 (D:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqkveyelseygrslegildmlcawganhinr

SCOP Domain Coordinates for d2hztd1:

Click to download the PDB-style file with coordinates for d2hztd1.
(The format of our PDB-style files is described here.)

Timeline for d2hztd1: