Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (5 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801)) |
Protein Putative transcriptional regulator YtcD [158294] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158295] (1 PDB entry) Uniprot O34533 10-104 |
Domain d2hztd1: 2hzt D:4-98 [147465] automatically matched to 2HZT A:4-98 complexed with csu |
PDB Entry: 2hzt (more details), 2 Å
SCOP Domain Sequences for d2hztd1:
Sequence, based on SEQRES records: (download)
>d2hztd1 a.4.5.69 (D:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy nqvppkveyelseygrslegildmlcawganhinr
>d2hztd1 a.4.5.69 (D:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy nqkveyelseygrslegildmlcawganhinr
Timeline for d2hztd1: