SCOPe 2.08: Domain d2hztd2: 2hzt D:4-98

Lineage for d2hztd2 (2hzt D:4-98)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries)

8. Domain d2hztd2: 2hzt D:4-98 [147465]
   Other proteins in same PDB: d2hzta1, d2hzta2, d2hztb3, d2hztc3, d2hztd3
   automated match to d1z7ub1

Details for d2hztd2

PDB Entry: 2hzt, 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd

PDB Compounds: (D:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hztd2:

Sequence, based on SEQRES records:

>d2hztd2 a.4.5.0 (D:4-98) automated matches {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records):

>d2hztd2 a.4.5.0 (D:4-98) automated matches {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqkveyelseygrslegildmlcawganhinr

Timeline for d2hztd2:

• d2hztd2 first appeared in SCOP 1.75, called d2hztd1
  
• d2hztd2 appears in SCOPe 2.07