SCOPe 2.03: Domain d2hztc_: 2hzt C:

Lineage for d2hztc_ (2hzt C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (4 PDB entries)

8. Domain d2hztc_: 2hzt C: [147464]
   Other proteins in same PDB: d2hzta1
   automated match to d1z7ub1

Details for d2hztc_

PDB Entry: 2hzt, 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd

PDB Compounds: (C:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hztc_:

Sequence, based on SEQRES records:

>d2hztc_ a.4.5.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
ivynqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records):

>d2hztc_ a.4.5.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
ivynqkveyelseygrslegildmlcawganhinr

Timeline for d2hztc_:

• d2hztc_ first appeared in SCOP 1.75, called d2hztc1
  
• d2hztc_ appears in SCOPe 2.02
  
• d2hztc_ appears in SCOPe 2.04
  
• d2hztc_ appears in the current release, SCOPe 2.08, called d2hztc2