Lineage for d2hztc_ (2hzt C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1080642Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1080643Protein automated matches [190154] (19 species)
    not a true protein
  7. 1080651Species Bacillus subtilis [TaxId:1423] [187193] (1 PDB entry)
  8. 1080653Domain d2hztc_: 2hzt C: [147464]
    Other proteins in same PDB: d2hzta1
    automated match to d1z7ub1

Details for d2hztc_

PDB Entry: 2hzt (more details), 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd
PDB Compounds: (C:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hztc_:

Sequence, based on SEQRES records: (download)

>d2hztc_ a.4.5.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
ivynqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records): (download)

>d2hztc_ a.4.5.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
ivynqkveyelseygrslegildmlcawganhinr

SCOPe Domain Coordinates for d2hztc_:

Click to download the PDB-style file with coordinates for d2hztc_.
(The format of our PDB-style files is described here.)

Timeline for d2hztc_: