SCOP 1.75: Domain d2hztc1: 2hzt C:4-98

Lineage for d2hztc1 (2hzt C:4-98)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.69: HxlR-like [140304] (5 proteins)
   Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family ((46801))

6. Protein Putative transcriptional regulator YtcD [158294] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158295] (1 PDB entry)
   Uniprot O34533 10-104

8. Domain d2hztc1: 2hzt C:4-98 [147464]
   automatically matched to 2HZT A:4-98
   complexed with csu

Details for d2hztc1

PDB Entry: 2hzt, 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd

PDB Compounds: (C:) Putative HTH-type transcriptional regulator ytcD

SCOP Domain Sequences for d2hztc1:

Sequence, based on SEQRES records:

>d2hztc1 a.4.5.69 (C:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records):

>d2hztc1 a.4.5.69 (C:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqkveyelseygrslegildmlcawganhinr

Timeline for d2hztc1:

• d2hztc1 is new in SCOP 1.75
  
• d2hztc1 is called d2hztc_ in SCOPe 2.01
  
• d2hztc1 appears in the current release, SCOPe 2.08, called d2hztc2