Lineage for d2hztc2 (2hzt C:4-98)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694577Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries)
  8. 2694585Domain d2hztc2: 2hzt C:4-98 [147464]
    Other proteins in same PDB: d2hzta1, d2hzta2, d2hztb3, d2hztc3, d2hztd3
    automated match to d1z7ub1

Details for d2hztc2

PDB Entry: 2hzt (more details), 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd
PDB Compounds: (C:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hztc2:

Sequence, based on SEQRES records: (download)

>d2hztc2 a.4.5.0 (C:4-98) automated matches {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqvppkveyelseygrslegildmlcawganhinr

Sequence, based on observed residues (ATOM records): (download)

>d2hztc2 a.4.5.0 (C:4-98) automated matches {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqkveyelseygrslegildmlcawganhinr

SCOPe Domain Coordinates for d2hztc2:

Click to download the PDB-style file with coordinates for d2hztc2.
(The format of our PDB-style files is described here.)

Timeline for d2hztc2: