![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [187193] (7 PDB entries) |
![]() | Domain d2hztb2: 2hzt B:4-98 [147463] Other proteins in same PDB: d2hzta1, d2hzta2, d2hztb3, d2hztc3, d2hztd3 automated match to d1z7ub1 |
PDB Entry: 2hzt (more details), 2 Å
SCOPe Domain Sequences for d2hztb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hztb2 a.4.5.0 (B:4-98) automated matches {Bacillus subtilis [TaxId: 1423]} veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy nqvppkveyelseygrslegildmlcawganhinr
Timeline for d2hztb2: