SCOPe 2.01: Domain d2hztb_: 2hzt B:

Lineage for d2hztb_ (2hzt B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (14 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (1 PDB entry)

8. Domain d2hztb_: 2hzt B: [147463]
   Other proteins in same PDB: d2hzta1
   automated match to d1z7ub1

Details for d2hztb_

PDB Entry: 2hzt, 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd

PDB Compounds: (B:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hztb_:

Sequence; same for both SEQRES and ATOM records:

>d2hztb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
ivynqvppkveyelseygrslegildmlcawganhinr

Timeline for d2hztb_:

• d2hztb_ first appeared in SCOP 1.75, called d2hztb1
  
• d2hztb_ appears in SCOPe 2.02
  
• d2hztb_ appears in the current release, SCOPe 2.08, called d2hztb2