Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (6 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801) |
Protein Putative transcriptional regulator YtcD [158294] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158295] (1 PDB entry) Uniprot O34533 10-104 |
Domain d2hzta1: 2hzt A:4-98 [147462] Other proteins in same PDB: d2hzta2, d2hztb2, d2hztb3, d2hztc2, d2hztc3, d2hztd2, d2hztd3 |
PDB Entry: 2hzt (more details), 2 Å
SCOPe Domain Sequences for d2hzta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy nqvppkveyelseygrslegildmlcawganhinr
Timeline for d2hzta1: