Lineage for d2hzta1 (2hzt A:4-98)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984048Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 1984060Protein Putative transcriptional regulator YtcD [158294] (1 species)
  7. 1984061Species Bacillus subtilis [TaxId:1423] [158295] (1 PDB entry)
    Uniprot O34533 10-104
  8. 1984062Domain d2hzta1: 2hzt A:4-98 [147462]
    Other proteins in same PDB: d2hzta2, d2hztb2, d2hztb3, d2hztc2, d2hztc3, d2hztd2, d2hztd3

Details for d2hzta1

PDB Entry: 2hzt (more details), 2 Å

PDB Description: crystal structure of a putative hth-type transcriptional regulator ytcd
PDB Compounds: (A:) Putative HTH-type transcriptional regulator ytcD

SCOPe Domain Sequences for d2hzta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]}
veatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinrivy
nqvppkveyelseygrslegildmlcawganhinr

SCOPe Domain Coordinates for d2hzta1:

Click to download the PDB-style file with coordinates for d2hzta1.
(The format of our PDB-style files is described here.)

Timeline for d2hzta1: