SCOP 1.75: Domain d2hz5a1: 2hz5 A:5-94

Lineage for d2hz5a1 (2hz5 A:5-94)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
   Pfam PF03259

6. Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118075] (4 PDB entries)
   Uniprot Q9NP97

8. Domain d2hz5a1: 2hz5 A:5-94 [147460]
   automatically matched to 2B95 A:11-106
   complexed with cs

Details for d2hz5a1

PDB Entry: 2hz5, 2.1 Å

PDB Description: Crystal structure of human dynein light chain Dnlc2A

PDB Compounds: (A:) Dynein light chain 2A, cytoplasmic

SCOP Domain Sequences for d2hz5a1:

Sequence, based on SEQRES records:

>d2hz5a1 d.110.7.1 (A:5-94) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
eetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqn
dltflrirskkneimvapdkdyfliviqnp

Sequence, based on observed residues (ATOM records):

>d2hz5a1 d.110.7.1 (A:5-94) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
eetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdidpqn
dltflrirskkneimvapyfliviqnp

Timeline for d2hz5a1:

• d2hz5a1 is new in SCOP 1.75
  
• d2hz5a1 is called d2hz5a_ in SCOPe 2.01
  
• d2hz5a1 appears in the current release, SCOPe 2.08, called d2hz5a_