Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.11: GpdQ-like [160875] (2 proteins) part of Pfam PF00149 |
Protein Rv0805 cyclic nucleotide phosphodiesterase [160876] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [160877] (3 PDB entries) Uniprot O06629 10-265 |
Domain d2hyoa1: 2hyo A:10-265 [147458] complexed with fe, mn; mutant |
PDB Entry: 2hyo (more details), 2.25 Å
SCOPe Domain Sequences for d2hyoa1:
Sequence, based on SEQRES records: (download)
>d2hyoa1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} prpdyvllhisdthliggdrrlygavdaddrlgelleqlnqsglrpdaivftgdladkge paayrklrglvepfaaqlgaelvwvmgahddraelrkflldeapsmapldrvcmidglri ivldtsvpghhhgeirasqlgwlaeelatpapdgtilalhhppipsvldmavtvelrdqa algrvlrgtdvrailaghlhystnatfvgipvsvasatcytqdltvaaggtrgrdgaqgc nlvhvypdtvvhsvip
>d2hyoa1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} prpdyvllhisdthlidaddrlgelleqlnqsglrpdaivftgdladkgepaayrklrgl vepfaaqlgaelvwvmgahddraelrkflldeapsmapldrvcmidglriivldtsvpgh hhgeirasqlgwlaeelatpapdgtilalhhppipsvldmavtvelrdqaalgrvlrgtd vrailaghlhystnatfvgipvsvasatcgcnlvhvypdtvvhsvip
Timeline for d2hyoa1: