Lineage for d2hyoa1 (2hyo A:10-265)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998432Family d.159.1.11: GpdQ-like [160875] (2 proteins)
    part of Pfam PF00149
  6. 2998449Protein Rv0805 cyclic nucleotide phosphodiesterase [160876] (1 species)
  7. 2998450Species Mycobacterium tuberculosis [TaxId:1773] [160877] (3 PDB entries)
    Uniprot O06629 10-265
  8. 2998453Domain d2hyoa1: 2hyo A:10-265 [147458]
    complexed with fe, mn; mutant

Details for d2hyoa1

PDB Entry: 2hyo (more details), 2.25 Å

PDB Description: crystal structure of rv0805 n97a mutant
PDB Compounds: (A:) Rv0805N97A

SCOPe Domain Sequences for d2hyoa1:

Sequence, based on SEQRES records: (download)

>d2hyoa1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]}
prpdyvllhisdthliggdrrlygavdaddrlgelleqlnqsglrpdaivftgdladkge
paayrklrglvepfaaqlgaelvwvmgahddraelrkflldeapsmapldrvcmidglri
ivldtsvpghhhgeirasqlgwlaeelatpapdgtilalhhppipsvldmavtvelrdqa
algrvlrgtdvrailaghlhystnatfvgipvsvasatcytqdltvaaggtrgrdgaqgc
nlvhvypdtvvhsvip

Sequence, based on observed residues (ATOM records): (download)

>d2hyoa1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]}
prpdyvllhisdthlidaddrlgelleqlnqsglrpdaivftgdladkgepaayrklrgl
vepfaaqlgaelvwvmgahddraelrkflldeapsmapldrvcmidglriivldtsvpgh
hhgeirasqlgwlaeelatpapdgtilalhhppipsvldmavtvelrdqaalgrvlrgtd
vrailaghlhystnatfvgipvsvasatcgcnlvhvypdtvvhsvip

SCOPe Domain Coordinates for d2hyoa1:

Click to download the PDB-style file with coordinates for d2hyoa1.
(The format of our PDB-style files is described here.)

Timeline for d2hyoa1: