SCOPe 2.08: Domain d2hyja1: 2hyj A:8-82

Lineage for d2hyja1 (2hyj A:8-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator SCO4940 [158250] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [158251] (1 PDB entry)
   Uniprot Q8CJS4 8-82

8. Domain d2hyja1: 2hyj A:8-82 [147456]
   Other proteins in same PDB: d2hyja2
   complexed with ca, so4

Details for d2hyja1

PDB Entry: 2hyj, 2.19 Å

PDB Description: The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor

PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2hyja1:

Sequence; same for both SEQRES and ATOM records:

>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
aeaqatrgrilgraaeiaseegldgitigrlaeelemsksgvhkhfgtketlqistldka
fvdfwhrvvepalae

Timeline for d2hyja1:

• d2hyja1 first appeared in SCOP 1.75
  
• d2hyja1 appears in SCOPe 2.07