| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Putative transcriptional regulator SCO4940 [158250] (1 species) |
| Species Streptomyces coelicolor [TaxId:1902] [158251] (1 PDB entry) Uniprot Q8CJS4 8-82 |
| Domain d2hyja1: 2hyj A:8-82 [147456] Other proteins in same PDB: d2hyja2 complexed with ca, so4 |
PDB Entry: 2hyj (more details), 2.19 Å
SCOPe Domain Sequences for d2hyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
aeaqatrgrilgraaeiaseegldgitigrlaeelemsksgvhkhfgtketlqistldka
fvdfwhrvvepalae
Timeline for d2hyja1: