Lineage for d2hybr_ (2hyb R:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528392Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2528393Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2528434Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 2528435Protein DsrH [142108] (1 species)
  7. 2528436Species Chromatium vinosum [TaxId:1049] [142109] (2 PDB entries)
    Uniprot O87898 2-102
  8. 2528443Domain d2hybr_: 2hyb R: [147455]
    Other proteins in same PDB: d2hyba_, d2hybb_, d2hybd_, d2hybe_, d2hybg_, d2hybh_, d2hybj_, d2hybk_, d2hybm_, d2hybn_, d2hybp_, d2hybq_
    automated match to d2hy5c1

Details for d2hybr_

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (R:) DsrH

SCOPe Domain Sequences for d2hybr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybr_ c.114.1.2 (R:) DsrH {Chromatium vinosum [TaxId: 1049]}
silhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyv
lgpdlkargfsdervipgisvvdyagfvdlttecdtvqawl

SCOPe Domain Coordinates for d2hybr_:

Click to download the PDB-style file with coordinates for d2hybr_.
(The format of our PDB-style files is described here.)

Timeline for d2hybr_: