Lineage for d2hybq1 (2hyb Q:5205-5336)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848497Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 848498Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 848499Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 848511Protein Intracellular sulfur oxidation protein DsrF [142102] (1 species)
  7. 848512Species Chromatium vinosum [TaxId:1049] [142103] (2 PDB entries)
    Uniprot O87897 5-136
  8. 848519Domain d2hybq1: 2hyb Q:5205-5336 [147454]
    Other proteins in same PDB: d2hyba1, d2hybc1, d2hybd1, d2hybf1, d2hybg1, d2hybi1, d2hybj1, d2hybl1, d2hybm1, d2hybo1, d2hybp1, d2hybr1
    automatically matched to d2hy5b1

Details for d2hybq1

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (Q:) Intracellular sulfur oxidation protein dsrF

SCOP Domain Sequences for d2hybq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybq1 c.114.1.1 (Q:5205-5336) Intracellular sulfur oxidation protein DsrF {Chromatium vinosum [TaxId: 1049]}
vkkfmylnrkapygtiyawealevvligaafdqdvcvlflddgvyqltrgqdtkgigmkn
fsptyrtlgdyevrriyvdrdsleargltqddlveiafedmeteeefdnivevidsarvs
elmnesdavfsf

SCOP Domain Coordinates for d2hybq1:

Click to download the PDB-style file with coordinates for d2hybq1.
(The format of our PDB-style files is described here.)

Timeline for d2hybq1: