Lineage for d2hybk_ (2hyb K:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168471Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2168472Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2168473Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2168485Protein Intracellular sulfur oxidation protein DsrF [142102] (1 species)
  7. 2168486Species Chromatium vinosum [TaxId:1049] [142103] (2 PDB entries)
    Uniprot O87897 5-136
  8. 2168491Domain d2hybk_: 2hyb K: [147448]
    Other proteins in same PDB: d2hyba_, d2hybc_, d2hybd_, d2hybf_, d2hybg_, d2hybi_, d2hybj_, d2hybl_, d2hybm_, d2hybo_, d2hybp_, d2hybr_
    automated match to d2hy5b1

Details for d2hybk_

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (K:) Intracellular sulfur oxidation protein dsrF

SCOPe Domain Sequences for d2hybk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybk_ c.114.1.1 (K:) Intracellular sulfur oxidation protein DsrF {Chromatium vinosum [TaxId: 1049]}
vkkfmylnrkapygtiyawealevvligaafdqdvcvlflddgvyqltrgqdtkgigmkn
fsptyrtlgdyevrriyvdrdsleargltqddlveiafedmeteeefdnivevidsarvs
elmnesdavfsf

SCOPe Domain Coordinates for d2hybk_:

Click to download the PDB-style file with coordinates for d2hybk_.
(The format of our PDB-style files is described here.)

Timeline for d2hybk_: