Lineage for d2hybd_ (2hyb D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528392Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2528393Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2528394Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2528415Protein Sulfurtransferase DsrE [142098] (1 species)
  7. 2528416Species Chromatium vinosum [TaxId:1049] [142099] (2 PDB entries)
    Uniprot O87896 1-130
  8. 2528419Domain d2hybd_: 2hyb D: [147441]
    Other proteins in same PDB: d2hybb_, d2hybc_, d2hybe_, d2hybf_, d2hybh_, d2hybi_, d2hybk_, d2hybl_, d2hybn_, d2hybo_, d2hybq_, d2hybr_
    automated match to d2hy5a1

Details for d2hybd_

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (D:) Putative sulfurtransferase dsrE

SCOPe Domain Sequences for d2hybd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybd_ c.114.1.1 (D:) Sulfurtransferase DsrE {Chromatium vinosum [TaxId: 1049]}
mkfalqinegpyqhqasdsayqfakaalekgheifrvffyhdgvnnstrlttppqddrhi
vnrwaelaeqyeldmvvcvaaaqrrgivdegeasrngkdatnihpkfrisglgqlveaai
qadrlvvfgd

SCOPe Domain Coordinates for d2hybd_:

Click to download the PDB-style file with coordinates for d2hybd_.
(The format of our PDB-style files is described here.)

Timeline for d2hybd_: