Lineage for d2hybc1 (2hyb C:402-502)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848497Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 848498Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 848539Family c.114.1.2: DsrH-like [117489] (3 proteins)
    Pfam PF04077
  6. 848540Protein DsrH [142108] (1 species)
  7. 848541Species Chromatium vinosum [TaxId:1049] [142109] (2 PDB entries)
    Uniprot O87898 2-102
  8. 848543Domain d2hybc1: 2hyb C:402-502 [147440]
    Other proteins in same PDB: d2hyba1, d2hybb1, d2hybd1, d2hybe1, d2hybg1, d2hybh1, d2hybj1, d2hybk1, d2hybm1, d2hybn1, d2hybp1, d2hybq1
    automatically matched to d2hy5c1

Details for d2hybc1

PDB Entry: 2hyb (more details), 2.5 Å

PDB Description: Crystal Structure of Hexameric DsrEFH
PDB Compounds: (C:) DsrH

SCOP Domain Sequences for d2hybc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hybc1 c.114.1.2 (C:402-502) DsrH {Chromatium vinosum [TaxId: 1049]}
silhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyv
lgpdlkargfsdervipgisvvdyagfvdlttecdtvqawl

SCOP Domain Coordinates for d2hybc1:

Click to download the PDB-style file with coordinates for d2hybc1.
(The format of our PDB-style files is described here.)

Timeline for d2hybc1: