Lineage for d2hxba_ (2hxb A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083304Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2083305Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2083306Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species)
    elaborated fold with additional structures
  7. 2083307Species Methanococcus jannaschii [TaxId:2190] [89426] (6 PDB entries)
    synonym: Methanocaldococcus jannaschii
  8. 2083317Domain d2hxba_: 2hxb A: [147431]
    automated match to d1pkha_

Details for d2hxba_

PDB Entry: 2hxb (more details), 2.55 Å

PDB Description: dctp deaminase-dutpase from methanocaldococcus jannaschii
PDB Compounds: (A:) dCTP deaminase, dUMP-forming

SCOPe Domain Sequences for d2hxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxba_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Methanococcus jannaschii [TaxId: 2190]}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv

SCOPe Domain Coordinates for d2hxba_:

Click to download the PDB-style file with coordinates for d2hxba_.
(The format of our PDB-style files is described here.)

Timeline for d2hxba_: