![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
![]() | Protein Bifunctional dCTP deaminase/dUTPase [89425] (1 species) elaborated fold with additional structures |
![]() | Species Methanococcus jannaschii [TaxId:2190] [89426] (6 PDB entries) synonym: Methanocaldococcus jannaschii |
![]() | Domain d2hxba_: 2hxb A: [147431] automated match to d1pkha_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hxb (more details), 2.55 Å
SCOPe Domain Sequences for d2hxba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxba_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Methanococcus jannaschii [TaxId: 2190]} milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadv
Timeline for d2hxba_: