Lineage for d2hwzl1 (2hwz L:4-106A)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741608Species Synthetic construct [TaxId:32630] [158859] (2 PDB entries)
  8. 2741609Domain d2hwzl1: 2hwz L:4-106A [147429]
    Other proteins in same PDB: d2hwzl2
    automatically matched to d1dqdl1

Details for d2hwzl1

PDB Entry: 2hwz (more details), 1.8 Å

PDB Description: fab fragment of humanized anti-viral antibody medi-493 (synagis tm)
PDB Compounds: (L:) Immunoglobulin Fab light chain

SCOPe Domain Sequences for d2hwzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwzl1 b.1.1.1 (L:4-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Synthetic construct [TaxId: 32630]}
mtqspstlsasvgdrvtitckcqlsvgymhwyqqkpgkapklliydtsklasgvpsrfsg
sgsgtaftltisslqpddfatyycfqgsgypftfgggtkleik

SCOPe Domain Coordinates for d2hwzl1:

Click to download the PDB-style file with coordinates for d2hwzl1.
(The format of our PDB-style files is described here.)

Timeline for d2hwzl1: