Lineage for d2hwjc_ (2hwj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009272Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 3009273Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 3009297Family d.268.1.3: Atu1540-like [160092] (2 proteins)
    Pfam PF08857; ParBc_2; contains extra C-terminal all-alpha subdomain
  6. 3009301Protein automated matches [190695] (1 species)
    not a true protein
  7. 3009302Species Agrobacterium tumefaciens [TaxId:176299] [187829] (1 PDB entry)
  8. 3009304Domain d2hwjc_: 2hwj C: [147423]
    Other proteins in same PDB: d2hwja1
    automated match to d2hwja1

Details for d2hwjc_

PDB Entry: 2hwj (more details), 2.61 Å

PDB Description: crystal structure of protein atu1540 from agrobacterium tumefaciens
PDB Compounds: (C:) Hypothetical protein Atu1540

SCOPe Domain Sequences for d2hwjc_:

Sequence, based on SEQRES records: (download)

>d2hwjc_ d.268.1.3 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yeprlsriaidklrptqiavgfrevelkrkewretrkkdgddflgnhivpvvagpkdray
lidhhhlvlalskegvehvltsevakfshlgkdefwsvmdhrnliypfdaqglrrqsgdi
pknihdleddpfrslagalrmaggyakviipfsefgwadflrrridrdllsdsfddalae
amklaksrearhlpgwcgve

Sequence, based on observed residues (ATOM records): (download)

>d2hwjc_ d.268.1.3 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yeprlsriaidklrptqiavgfrevelkrkewretrdflgnhivpvvagpkdraylidhh
hlvlalskegvehvltsevakfshlgkdefwsvmdhrnliypfdaqglrrqsgdipknih
dleddpfrslagalrmaggyakviipfsefgwadflrrridrdllsdsfddalaeamkla
ksrearhlpgwcgve

SCOPe Domain Coordinates for d2hwjc_:

Click to download the PDB-style file with coordinates for d2hwjc_.
(The format of our PDB-style files is described here.)

Timeline for d2hwjc_: