Lineage for d2hw8a1 (2hw8 A:1-228)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625308Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2625309Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2625310Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2625311Protein Ribosomal protein L1 [56810] (4 species)
  7. 2625322Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 2625324Domain d2hw8a1: 2hw8 A:1-228 [147420]
    protein/RNA complex; complexed with bu1, k, mg

Details for d2hw8a1

PDB Entry: 2hw8 (more details), 2.1 Å

PDB Description: Structure of ribosomal protein L1-mRNA complex at 2.1 resolution.
PDB Compounds: (A:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2hw8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hw8a1 e.24.1.1 (A:1-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
gavgskmgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d2hw8a1:

Click to download the PDB-style file with coordinates for d2hw8a1.
(The format of our PDB-style files is described here.)

Timeline for d2hw8a1: